PDB entry 1ee0

View 1ee0 on RCSB PDB site
Description: 2-pyrone synthase complexed with acetoacetyl-coa
Deposited on 2000-01-28, released 2001-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 2001-01-31, with a file datestamp of 2001-01-31.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee0A (A:)
    glatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylalte
    dylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifcttag
    vdmpgadyqlvkllglspsvkrymlyqqgaaaggtvlrlakdlaennkgsrvlivcseit
    ailfhgpnenhldslvaqalfgdgaaalivgsgphlaverpifeivstdqtilpdtekam
    klhlreggltfqlhrdvplmvaknienaaekalsplgitdwnsvfwmvhpggraildqve
    rklnlkedklrasrhvlseygnlisacvlfiidevrkrsmaegksttgegldcgvlfgfg
    pgmtvetvvlrsvrvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee0B (B:)
    glatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylalte
    dylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifcttag
    vdmpgadyqlvkllglspsvkrymlyqqgaaaggtvlrlakdlaennkgsrvlivcseit
    ailfhgpnenhldslvaqalfgdgaaalivgsgphlaverpifeivstdqtilpdtekam
    klhlreggltfqlhrdvplmvaknienaaekalsplgitdwnsvfwmvhpggraildqve
    rklnlkedklrasrhvlseygnlisacvlfiidevrkrsmaegksttgegldcgvlfgfg
    pgmtvetvvlrsvrv