PDB entry 1edy

View 1edy on RCSB PDB site
Description: crystal structure of rat alpha 1-macroglobulin receptor binding domain
Deposited on 2000-01-28, released 2000-12-01
The last revision prior to the SCOP 1.61 freeze date was dated 2000-12-01, with a file datestamp of 2000-12-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1edya_
  • Chain 'B':
    Domains in SCOP 1.61: d1edyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edyA (A:)
    eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
    klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
    faieeysapfssds
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edyB (B:)
    eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
    klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
    faieeysapf