PDB entry 1edy

View 1edy on RCSB PDB site
Description: crystal structure of rat alpha 1-macroglobulin receptor binding domain
Class: protein binding
Keywords: beta sandwich, pseudo-symmetric dimer, PROTEIN BINDING
Deposited on 2000-01-28, released 2000-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha 1-macroglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1edya_
  • Chain 'B':
    Compound: alpha 1-macroglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1edyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edyA (A:)
    eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
    klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
    faieeysapfssds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1edyB (B:)
    eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
    klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
    faieeysapfssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1edyB (B:)
    eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
    klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
    faieeysapf