PDB entry 1edv

View 1edv on RCSB PDB site
Description: solution structure of 2nd intradiskal loop of bovine rhodopsin (residues 172-205)
Class: Ion Transport
Keywords: helix-turn-helix, Ion Transport
Deposited on 2000-01-28, released 2000-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rhodopsin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02699 (0-33)
  Domains in SCOPe 2.08: d1edva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1edvA (A:)
  lvgwsryipegmqcscgidyytpheetnnesfvi