PDB entry 1edv

View 1edv on RCSB PDB site
Description: solution structure of 2nd intradiskal loop of bovine rhodopsin (residues 172-205)
Class: Ion Transport
Keywords: helix-turn-helix, Ion Transport
Deposited on 2000-01-28, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhodopsin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1edva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edvA (A:)
    lvgwsryipegmqcscgidyytpheetnnesfvi