PDB entry 1edu

View 1edu on RCSB PDB site
Description: crystal structure of the enth domain of rat epsin 1
Class: endocytosis/exocytosis
Keywords: alpha-helix, endocytosis-exocytosis complex
Deposited on 2000-01-28, released 2000-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EH domain binding protein EPSIN
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88339 (0-148)
      • modified residue (28)
      • modified residue (45)
      • modified residue (47)
      • modified residue (66)
      • modified residue (69)
      • modified residue (88)
    Domains in SCOPe 2.08: d1edua_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eduA (A:)
    nivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknw
    rhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlv
    allrdedrlreerahalktkeklaqtata