PDB entry 1edt

View 1edt on RCSB PDB site
Description: crystal structure of endo-beta-n-acetylglucosaminidase h at 1.9 angstroms resolution: active site geometry and substrate recognition
Class: hydrolase (glucosidase)
Keywords: hydrolase (glucosidase)
Deposited on 1995-03-31, released 1995-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-n-acetylglucosaminidase h, endo h
    Species: Streptomyces plicatus [TaxId:1922]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1edta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1edtA (A:)
    apapvkqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylh
    fnenvqrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdava
    kygldgvdfddeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyg
    gvdvsdkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygv
    yltynldggdrtadvsaftrelygseavrtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1edtA (A:)
    kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
    qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
    gvdfddeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
    dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
    ldggdrtadvsaftrelygseavrt