PDB entry 1edq

View 1edq on RCSB PDB site
Description: crystal structure of chitinase a from s. marcescens at 1.55 angstroms
Class: hydrolase
Keywords: beta-alpha (tim) barrel, hydrolase
Deposited on 2000-01-28, released 2000-02-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.188
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase a
    Species: Serratia marcescens [TaxId:615]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O83008 (0-539)
      • conflict (451)
    Domains in SCOPe 2.04: d1edqa1, d1edqa2, d1edqa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edqA (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlaplke
    plleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwefpggkgan
    pnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq