PDB entry 1edo

View 1edo on RCSB PDB site
Description: the x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with nadp+
Class: oxidoreductase
Keywords: nucleotide fold, rossmann fold, OXIDOREDUCTASE
Deposited on 2000-01-28, released 2001-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-keto acyl carrier protein reductase
    Species: Brassica napus [TaxId:3708]
    Gene: OIL SEED RAPE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1edoa_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edoA (A:)
    spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
    skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
    atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
    pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
    giai