PDB entry 1edk

View 1edk on RCSB PDB site
Description: staphylococcal protein a e-domain (-60), nmr, minimized average structure
Class: immunoglobulin-binding protein
Keywords: immunoglobulin-binding protein, repeat, transmembrane, cell wall, signal, igg-binding protein
Deposited on 1996-07-22, released 1997-04-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal protein a
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1edka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edkA (A:)
    aqhdeaqqnafyqvlnmpnlnadqrngfiqslkddpsqsanvlgeaqklndsqapk