PDB entry 1edj

View 1edj on RCSB PDB site
Description: staphylococcal protein a e-domain (180), nmr, 20 structures
Deposited on 1996-10-07, released 1997-04-01
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1edj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edj_ (-)
    aqhdeaqqnafyqvlnmpnlnadqrngfiqslkddpsqsanvlgeaqklndsqapk