PDB entry 1edh

View 1edh on RCSB PDB site
Description: e-cadherin domains 1 and 2 in complex with calcium
Class: cell adhesion protein
Keywords: cadherin, cell adhesion protein, calcium binding protein
Deposited on 1996-05-15, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e-cadherin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1edha1, d1edha2
  • Chain 'B':
    Compound: e-cadherin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1edhb1, d1edhb2
  • Heterogens: HG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1edhA (A:)
    mrdwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretg
    wlkvtqpldreaiakyilyshavssngeavedpmeivitvtdqndnrpeftqevfegsva
    egavpgtsvmkvsatdadddvntynaaiaytivsqdpelphknmftvnrdtgvisvltsg
    ldresyptytlvvqaadlqgeglsttakavitvkdindnapvfnps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1edhA (A:)
    vippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlkv
    tqpldreaiakyilyshavssngeavedpmeivitvtdqndnrpeftqevfegsvaegav
    pgtsvmkvsatdadddvntynaaiaytivsqdpelphknmftvnrdtgvisvltsgldre
    syptytlvvqaadlqgeglsttakavitvkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1edhB (B:)
    mrdwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretg
    wlkvtqpldreaiakyilyshavssngeavedpmeivitvtdqndnrpeftqevfegsva
    egavpgtsvmkvsatdadddvntynaaiaytivsqdpelphknmftvnrdtgvisvltsg
    ldresyptytlvvqaadlqgeglsttakavitvkdindnapvfnps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1edhB (B:)
    vippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlkv
    tqpldreaiakyilyshavssngeavedpmeivitvtdqndnrpeftqevfegsvaegav
    pgtsvmkvsatdadddvntynaaiaytivsqdpelphknmftvnrdtgvisvltsgldre
    syptytlvvqaadlqgeglsttakavitvkd