PDB entry 1ed8

View 1ed8 on RCSB PDB site
Description: structure of e. coli alkaline phosphatase inhibited by the inorganic phosphate at 1.75a resolution
Class: hydrolase
Keywords: wild type, inhibited by phosphate, HYDROLASE
Deposited on 2000-01-27, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ed8a_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ed8b_
  • Heterogens: ZN, MG, PO4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed8A (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed8B (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk