PDB entry 1ed7

View 1ed7 on RCSB PDB site
Description: solution structure of the chitin-binding domain of bacillus circulans wl-12 chitinase a1
Class: hydrolase
Keywords: twisted beta-sandwich, HYDROLASE
Deposited on 2000-01-27, released 2000-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase a1
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ed7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed7A (A:)
    awqvntaytagqlvtyngktykclqphtslagwepsnvpalwqlq