PDB entry 1ed3

View 1ed3 on RCSB PDB site
Description: crystal structure of rat minor histocompatibility antigen complex rt1-aa/mtf-e.
Class: immune system
Keywords: major histocompatibility complex, rat minor histocompatibility complex, MHC, immunology, peptide antigen presentation, cellular immunity, cell surface receptor, T cell receptor ligand, IMMUNE SYSTEM
Deposited on 2000-01-26, released 2001-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I major histocompatibility antigen rt1-aa
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ed3a1, d1ed3a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ed3b_
  • Chain 'C':
    Compound: peptide mtf-e (13n3e)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: class I major histocompatibility antigen rt1-aa
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ed3d1, d1ed3d2
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ed3e_
  • Chain 'F':
    Compound: peptide mtf-e (13n3e)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed3A (A:)
    gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
    eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
    rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
    rsdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed3B (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed3D (D:)
    gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
    eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
    rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
    rsdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed3E (E:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'F':
    No sequence available.