PDB entry 1ed3

View 1ed3 on RCSB PDB site
Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.
Deposited on 2000-01-26, released 2001-02-28
The last revision prior to the SCOP 1.67 freeze date was dated 2001-02-28, with a file datestamp of 2001-02-28.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed3A (A:)
    gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
    eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
    rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
    rsdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed3B (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed3D (D:)
    gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
    eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
    rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
    rsdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ed3E (E:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm