PDB entry 1ed1

View 1ed1 on RCSB PDB site
Description: crystal structure of simian immunodeficiency virus matrix antigen (siv ma) at 100k.
Class: Viral protein
Keywords: Trimeric Association, Viral protein
Deposited on 2000-01-26, released 2000-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Simian immunodeficiency virus - mac [TaxId:11711]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ed1a_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ed1A (A:)
mgarnsvlsgkkadelekirlrpggkkkymlkhvvwaaneldrfglaesllenkegcqki
lsvlaplvptgsenlkslyntvcviwcihaeekvkhteeakqivqrhlvvetgtaetmpk
tsrptapssgrggny

    Sequence, based on observed residues (ATOM records): (download) 
    >1ed1A (A:)
svlsgkkadelekirlrpggkkkymlkhvvwaaneldrfglaesllenkegcqkilsvla
plvptgsenlkslyntvcviwcihaeekvkhteeakqivqrhlvvetgtaetmp