PDB entry 1ecy

View 1ecy on RCSB PDB site
Description: protease inhibitor ecotin
Class: protease inhibitor
Keywords: beta-sheet structure, serine protease inhibitor, periplasmic, protease inhibitor
Deposited on 1996-08-06, released 1997-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ecotin
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23827 (0-141)
  Domains in SCOPe 2.08: d1ecya_
• Heterogens: GLC, BGC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ecyA (A:)
  aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
  nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
  dnvdvkyrvwkaeekidnavvr