PDB entry 1ecs

View 1ecs on RCSB PDB site
Description: the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5
Deposited on 2000-01-25, released 2001-05-02
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ecsa_
  • Chain 'B':
    Domains in SCOP 1.57: d1ecsb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ecsA (A:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqnel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ecsB (B:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqnel