PDB entry 1ecs

View 1ecs on RCSB PDB site
Description: the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5
Class: antibiotic inhibitor
Keywords: arm-exchange, antibiotic inhibitor
Deposited on 2000-01-25, released 2001-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bleomycin resistance protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13081
      • conflict (97)
    Domains in SCOPe 2.07: d1ecsa_
  • Chain 'B':
    Compound: bleomycin resistance protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13081
      • conflict (97)
    Domains in SCOPe 2.07: d1ecsb_
  • Heterogens: CA, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ecsA (A:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecsA (A:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqnel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ecsB (B:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecsB (B:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqnel