PDB entry 1ecp

View 1ecp on RCSB PDB site
Description: purine nucleoside phosphorylase
Class: pentosyltransferase
Keywords: pentosyltransferase, purine nucleoside phosphorylase, glycosyltransferase
Deposited on 1995-07-13, released 1996-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecpa_
  • Chain 'B':
    Compound: purine nucleoside phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecpb_
  • Chain 'C':
    Compound: purine nucleoside phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecpc_
  • Chain 'D':
    Compound: purine nucleoside phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecpd_
  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecpe_
  • Chain 'F':
    Compound: purine nucleoside phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecpf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ecpA (A:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecpA (A:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ecpB (B:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecpB (B:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ecpC (C:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecpC (C:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ecpD (D:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecpD (D:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ecpE (E:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecpE (E:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ecpF (F:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecpF (F:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk