PDB entry 1ecm

View 1ecm on RCSB PDB site
Description: atomic structure of the buried catalytic pocket of escherichia coli chorismate mutase
Class: chorismate mutase
Keywords: p-protein, chorismate mutase domain, chorismate mutase
Deposited on 1994-11-28, released 1995-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-oxabicyclic transition state analogue
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ecma_
  • Chain 'B':
    Compound: endo-oxabicyclic transition state analogue
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ecmb_
  • Heterogens: TSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ecmA (A:)
    mtsenpllalrekisaldekllallaerrelavevgkakllshrpvrdidrerdllerli
    tlgkahhldahyitrlfqliiedsvltqqallqqhlnkinphsariafl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecmA (A:)
    npllalrekisaldekllallaerrelavevgkakllshrpvrdidrerdllerlitlgk
    ahhldahyitrlfqliiedsvltqqallqqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ecmB (B:)
    mtsenpllalrekisaldekllallaerrelavevgkakllshrpvrdidrerdllerli
    tlgkahhldahyitrlfqliiedsvltqqallqqhlnkinphsariafl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecmB (B:)
    pllalrekisaldekllallaerrelavevgkakllshrpvrdidrerdllerlitlgka
    hhldahyitrlfqliiedsvltqqallqqhlnkin