PDB entry 1eck

View 1eck on RCSB PDB site
Description: adenylate kinase with bound amp and ADP
Class: phosphotransferase
Keywords: phosphotransferase,transferase, kinase, ATP-binding
Deposited on 1996-05-13, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 1996-11-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.177
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecka1, d1ecka2
  • Chain 'B':
    Compound: adenylate kinase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eckb1, d1eckb2
  • Heterogens: AMP, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eckA (A:)
    mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eckB (B:)
    mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg