PDB entry 1ecg

View 1ecg on RCSB PDB site
Description: don inactivated escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase
Class: transferase (glutamine amidotransferase)
Keywords: purine biosynthesis, transferase, glycosyltransferase, glutamine amidotransferase, transferase (glutamine amidotransferase)
Deposited on 1996-04-23, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.147
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecga1, d1ecga2
  • Chain 'B':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecgb1, d1ecgb2
  • Heterogens: ONL, PIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ecgA (A:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlemhneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecgA (A:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ecgB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlemhneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecgB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlem