PDB entry 1ecf

View 1ecf on RCSB PDB site
Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase
Deposited on 1996-04-23, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-11, with a file datestamp of 2000-02-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ecfA (A:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ecfB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlem