PDB entry 1ece

View 1ece on RCSB PDB site
Description: acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose
Deposited on 1996-04-04, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ecea_
  • Chain 'B':
    Domains in SCOP 1.55: d1eceb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eceA (A:)
    agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
    irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
    sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
    aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
    atsvypqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
    qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtvkdgylapikssifdpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eceB (B:)
    agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
    irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
    sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
    aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
    atsvypqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
    qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtvkdgylapikssifdpv