PDB entry 1ece

View 1ece on RCSB PDB site
Description: acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose
Class: glycosyl hydrolase
Keywords: cellulase, endocellulase, glycosyl hydrolase
Deposited on 1996-04-04, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endocellulase e1
    Species: Acidothermus cellulolyticus [TaxId:28049]
    Gene: PVU I FRAGMENT OF A.
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecea_
  • Chain 'B':
    Compound: endocellulase e1
    Species: Acidothermus cellulolyticus [TaxId:28049]
    Gene: PVU I FRAGMENT OF A.
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eceb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eceA (A:)
    agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
    irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
    sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
    aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
    atsvypqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
    qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtvkdgylapikssifdpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eceB (B:)
    agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
    irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
    sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
    aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
    atsvypqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
    qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtvkdgylapikssifdpv