PDB entry 1ecc

View 1ecc on RCSB PDB site
Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with mn-cprpp and 5-oxo-norleucine
Class: transferase
Keywords: transferase, glutamine amidotransferase, purine biosynthesis, glycosyltransferase
Deposited on 1997-07-09, released 1998-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.176
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecca1, d1ecca2
  • Chain 'B':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: PURF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eccb1, d1eccb2
  • Heterogens: MN, ONL, PCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eccA (A:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlemhneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eccA (A:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eccB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrqnevenlemhneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eccB (B:)
    cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
    qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
    hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
    frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
    rqcadnpvsnpclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvip
    ipetscdialeiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdk
    nvllvddsivrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgr
    evdeirqiigadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldt
    lrnddakavqrq