PDB entry 1eca

View 1eca on RCSB PDB site
Description: structure of erythrocruorin in different ligand states refined at 1.4 angstroms resolution
Deposited on 1979-03-07, released 1979-07-05
The last revision prior to the SCOP 1.69 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1eca__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eca_ (-)
  lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan
  rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa
  wgatldtffgmifskm