PDB entry 1eca

View 1eca on RCSB PDB site
Description: structure of erythrocruorin in different ligand states refined at 1.4 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1979-03-07, released 1979-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythrocruorin (aquo met)
    Species: Chironomus thummi thummi [TaxId:7155]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecaa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ecaA (A:)
    lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan
    rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa
    wgatldtffgmifskm