PDB entry 1ec9

View 1ec9 on RCSB PDB site
Description: e. coli glucarate dehydratase bound to xylarohydroxamate
Class: lyase
Keywords: Glucarate Dehydratase Enolase Enzyme Superfamily TIM Barrel (beta/alpha)7beta barrel, LYASE
Deposited on 2000-01-25, released 2000-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ec9a1, d1ec9a2
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ec9b1, d1ec9b2
  • Chain 'C':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ec9c1, d1ec9c2
  • Chain 'D':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ec9d1, d1ec9d2
  • Heterogens: MG, XYH, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ec9A (A:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec9A (A:)
    qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
    tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
    lgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeam
    tpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawsln
    eaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtls
    lqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkit
    aidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgard
    damgmqylipgwtfdnkrpcmvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ec9B (B:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec9B (B:)
    qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
    tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
    lgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeam
    tpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawsln
    eaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtls
    lqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkit
    aidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgard
    damgmqylipgwtfdnkrpcmvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ec9C (C:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec9C (C:)
    qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
    tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
    lgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeam
    tpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawsln
    eaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtls
    lqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkit
    aidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgard
    damgmqylipgwtfdnkrpcmvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ec9D (D:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec9D (D:)
    sqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekir
    ktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamld
    llgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheea
    mtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawsl
    neaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtl
    slqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgki
    taidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgar
    ddamgmqylipgwtfdnkrpcmvr