PDB entry 1ec8

View 1ec8 on RCSB PDB site
Description: e. coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo-hexanedioate
Class: lyase
Keywords: Glucarate Dehydratase Enolase Enzyme Superfamily TIM Barrel (beta/alpha)7beta barrel, LYASE
Deposited on 2000-01-25, released 2000-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ec8a1, d1ec8a2
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ec8b1, d1ec8b2
  • Chain 'C':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ec8c1, d1ec8c2
  • Chain 'D':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ec8d1, d1ec8d2
  • Heterogens: MG, GLR, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ec8A (A:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec8A (A:)
    fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
    ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
    gqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamt
    pdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslne
    aikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlsl
    qsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkita
    idthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardd
    amgmqylipgwtfdnkrpcmvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ec8B (B:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec8B (B:)
    fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
    ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
    gqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamt
    pdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslne
    aikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlsl
    qsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkita
    idthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardd
    amgmqylipgwtfdnkrpcmvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ec8C (C:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec8C (C:)
    fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
    ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
    gqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamt
    pdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslne
    aikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlsl
    qsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkita
    idthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardd
    amgmqylipgwtfdnkrpcmvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ec8D (D:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec8D (D:)
    fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
    ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
    gqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamt
    pdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslne
    aikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlsl
    qsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkita
    idthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardd
    amgmqylipgwtfdnkrpcmvr