PDB entry 1ec6

View 1ec6 on RCSB PDB site
Description: crystal structure of nova-2 kh3 k-homology RNA-binding domain bound to 20-mer RNA hairpin
Class: RNA binding protein/RNA
Keywords: KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA BINDING PROTEIN/RNA COMPLEX
Deposited on 2000-01-25, released 2000-02-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein nova-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNW9 (0-86)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1ec6a1, d1ec6a2
  • Chain 'B':
    Compound: RNA-binding protein nova-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNW9 (0-End)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1ec6b1, d1ec6b2
  • Chain 'C':
    Compound: 20-mer RNA hairpin
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 20-mer RNA hairpin
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec6A (A:)
    mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtyeqgvrasnpqkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ec6B (B:)
    mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtyeqgvrasnpqkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec6B (B:)
    mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtyeqgvrasnp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.