PDB entry 1ec6

View 1ec6 on RCSB PDB site
Description: crystal structure of nova-2 kh3 k-homology RNA-binding domain bound to 20-mer RNA hairpin
Class: RNA binding protein/RNA
Keywords: KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA BINDING PROTEIN/RNA COMPLEX
Deposited on 2000-01-25, released 2000-02-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA-binding protein nova-2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UNW9 (0-86)
    • cloning artifact (0)
  Domains in SCOPe 2.05: d1ec6a_
• Chain 'B':
  Compound: RNA-binding protein nova-2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UNW9 (0-End)
    • cloning artifact (0)
  Domains in SCOPe 2.05: d1ec6b_
• Chain 'C':
  Compound: 20-mer RNA hairpin
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: 20-mer RNA hairpin
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ec6A (A:)
  mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
  atqaaqylisqrvtyeqgvrasnpqkv
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1ec6B (B:)
  mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
  atqaaqylisqrvtyeqgvrasnpqkv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ec6B (B:)
  mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
  atqaaqylisqrvtyeqgvrasnp
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.