PDB entry 1ec6

View 1ec6 on RCSB PDB site
Description: crystal structure of nova-2 kh3 k-homology rna-binding domain bound to 20-mer rna hairpin
Deposited on 2000-01-25, released 2000-02-21
The last revision prior to the SCOP 1.71 freeze date was dated 2000-04-07, with a file datestamp of 2000-04-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ec6a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ec6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec6A (A:)
    mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtyeqgvrasnpqkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ec6B (B:)
    mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtyeqgvrasnpqkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ec6B (B:)
    mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtyeqgvrasnp