PDB entry 1ec5

View 1ec5 on RCSB PDB site
Description: crystal structure of four-helix bundle model
Class: de novo protein
Keywords: alpha-helical bundle, protein design, de novo protein
Deposited on 2000-01-25, released 2000-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (four-helix bundle model)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1EC5
    Domains in SCOPe 2.07: d1ec5a_
  • Chain 'B':
    Compound: protein (four-helix bundle model)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1EC5
    Domains in SCOPe 2.07: d1ec5b_
  • Chain 'C':
    Compound: protein (four-helix bundle model)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1EC5
    Domains in SCOPe 2.07: d1ec5c_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec5A (A:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec5B (B:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec5C (C:)
    dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg