PDB entry 1ec5

View 1ec5 on RCSB PDB site
Description: crystal structure of four-helix bundle model
Class: de novo protein
Keywords: alpha-helical bundle, protein design, de novo protein
Deposited on 2000-01-25, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (four-helix bundle model)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1EC5
  Domains in SCOPe 2.08: d1ec5a_
• Chain 'B':
  Compound: protein (four-helix bundle model)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1EC5
  Domains in SCOPe 2.08: d1ec5b_
• Chain 'C':
  Compound: protein (four-helix bundle model)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1EC5
  Domains in SCOPe 2.08: d1ec5c_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ec5A (A:)
  dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ec5B (B:)
  dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ec5C (C:)
  dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg