PDB entry 1eby

View 1eby on RCSB PDB site
Description: HIV-1 protease in complex with the inhibitor BEA369
Class: hydrolase/hydrolase inhibitor
Keywords: Dimer, protein-inhibitor complex, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-01-25, released 2002-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.185
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366
    • conflict (36)
  Domains in SCOPe 2.08: d1ebya_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
    • conflict (36)
  Domains in SCOPe 2.08: d1ebyb_
• Heterogens: BEB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ebyA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ebyB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf