PDB entry 1ebt

View 1ebt on RCSB PDB site
Description: hemoglobin I from the clam lucina pectinata bound with cyanide
Class: oxygen transport
Keywords: oxygen transport, hemoglobin, oxygen carrier, globin
Deposited on 1998-11-04, released 2000-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Lucina pectinata [TaxId:29163]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41260 (0-141)
      • see remark 999 (2)
      • see remark 999 (7)
      • see remark 999 (140)
    Domains in SCOPe 2.06: d1ebta_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebtA (A:)
    slsaaqkdnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
    maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
    ggdegawtavagalmgeiepnm