PDB entry 1ebt

View 1ebt on RCSB PDB site
Description: hemoglobin i from the clam lucina pectinata bound with cyanide
Deposited on 1998-11-04, released 2000-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2000-01-13, with a file datestamp of 2000-01-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1ebt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebt_ (-)
    slsaaqkdnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
    maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
    ggdegawtavagalmgeiepnm