PDB entry 1ebp

View 1ebp on RCSB PDB site
Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an agonist peptide [emp1]
Deposited on 1996-05-07, released 1997-07-29
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-29, with a file datestamp of 1997-07-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebpA (A:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvsllt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebpB (B:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvsllt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.