PDB entry 1ebp

View 1ebp on RCSB PDB site
Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an agonist peptide [emp1]
Class: complex (cytokine receptor/peptide)
Keywords: erythropoietin receptor, signal transduction, protein minimization, drug design, cytokine receptor class 1, complex (cytokine receptor/peptide)
Deposited on 1996-05-07, released 1997-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epo receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebpa1, d1ebpa2
  • Chain 'B':
    Compound: epo receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebpb1, d1ebpb2
  • Chain 'C':
    Compound: epo mimetics peptide 1
    Database cross-references and differences (RAF-indexed):
    • PDB 1EBP
    Domains in SCOPe 2.07: d1ebpc_
  • Chain 'D':
    Compound: epo mimetics peptide 1
    Database cross-references and differences (RAF-indexed):
    • PDB 1EBP
    Domains in SCOPe 2.07: d1ebpd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebpA (A:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvsllt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebpB (B:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvsllt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ebpC (C:)
    ggtyschfgpltwvckpqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ebpC (C:)
    tyschfgpltwvckpq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ebpD (D:)
    ggtyschfgpltwvckpqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ebpD (D:)
    tyschfgpltwvckpq