PDB entry 1ebo

View 1ebo on RCSB PDB site
Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain
Class: Viral protein
Keywords: MEMBRANE FUSION SUBUNIT, Viral protein
Deposited on 1998-11-03, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.239
AEROSPACI score: -1.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2
    Species: Ebola virus sp. [TaxId:205488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q913A3
    • GB 1EBOB
    • GB 1EBOC
    • GB 1EBOD
    • GB 1EBOE
    • GB 1EBOF
    Domains in SCOPe 2.07: d1eboa1, d1eboa2
  • Chain 'B':
    Compound: ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2
    Species: Ebola virus sp. [TaxId:205488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q913A3
    • GB 1EBOB
    • GB 1EBOC
    • GB 1EBOD
    • GB 1EBOE
    • GB 1EBOF
    Domains in SCOPe 2.07: d1ebob1, d1ebob2
  • Chain 'C':
    Compound: ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2
    Species: Ebola virus sp. [TaxId:205488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q913A3
    • GB 1EBOB
    • GB 1EBOC
    • GB 1EBOD
    • GB 1EBOE
    • GB 1EBOF
    Domains in SCOPe 2.07: d1eboc1, d1eboc2
  • Chain 'D':
    Compound: ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2
    Species: Ebola virus sp. [TaxId:205488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q913A3
    • GB 1EBOB
    • GB 1EBOC
    • GB 1EBOD
    • GB 1EBOE
    • GB 1EBOF
    Domains in SCOPe 2.07: d1ebod1, d1ebod2
  • Chain 'E':
    Compound: ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2
    Species: Ebola virus sp. [TaxId:205488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q913A3
    • GB 1EBOB
    • GB 1EBOC
    • GB 1EBOD
    • GB 1EBOE
    • GB 1EBOF
    Domains in SCOPe 2.07: d1eboe1, d1eboe2
  • Chain 'F':
    Compound: ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2
    Species: Ebola virus sp. [TaxId:205488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q913A3
    • GB 1EBOB
    • GB 1EBOC
    • GB 1EBOD
    • GB 1EBOE
    • GB 1EBOF
    Domains in SCOPe 2.07: d1ebof1, d1ebof2
  • Heterogens: ZN, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eboA (A:)
    mkqiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattel
    rtfsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdktlpdqg
    dndnwwtgwrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eboA (A:)
    qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
    fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eboB (B:)
    mkqiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattel
    rtfsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdktlpdqg
    dndnwwtgwrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eboB (B:)
    qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
    fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eboC (C:)
    mkqiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattel
    rtfsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdktlpdqg
    dndnwwtgwrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eboC (C:)
    qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
    fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eboD (D:)
    mkqiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattel
    rtfsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdktlpdqg
    dndnwwtgwrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eboD (D:)
    qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
    fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1eboE (E:)
    mkqiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattel
    rtfsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdktlpdqg
    dndnwwtgwrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eboE (E:)
    qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
    fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1eboF (F:)
    mkqiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattel
    rtfsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdktlpdqg
    dndnwwtgwrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eboF (F:)
    qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
    fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvdkt