PDB entry 1ebm

View 1ebm on RCSB PDB site
Description: crystal structure of the human 8-oxoguanine glycosylase (hogg1) bound to a substrate oligonucleotide
Class: lyase/DNA
Keywords: DNA repair, DNA glycosylase, protein/DNA, LYASE/DNA COMPLEX
Deposited on 2000-01-24, released 2000-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (0-316)
      • conflict (0-2)
      • conflict (240)
    Domains in SCOPe 2.07: d1ebma1, d1ebma2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*gp*tp*cp*cp*ap*(8og)p*gp*tp*cp*tp*ap*cp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3')
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ebmA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
    gvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqala
    gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
    qvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
    pyagwaqavlfsadlrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ebmA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqva
    dciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.