PDB entry 1ebl

View 1ebl on RCSB PDB site
Description: the 1.8 a crystal structure and active site architecture of beta-ketoacyl-[acyl carrier protein] synthase III (fabh) from escherichia coli
Class: transferase
Keywords: acyltransferase, condensing enzyme, fatty acid synthesis, lipid metabolism, alpha-beta protein, five-layered fold, coenzyme a binding protein, helix dipole, malonyl coa decarboxylating enzyme
Deposited on 2000-01-24, released 2000-02-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ketoacyl-acp synthase III
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6R0 (0-316)
      • modified residue (0)
      • modified residue (24)
      • modified residue (53)
      • modified residue (64)
      • modified residue (96)
      • modified residue (206)
      • modified residue (259)
      • modified residue (261)
    Domains in SCOPe 2.05: d1ebla1, d1ebla2
  • Chain 'B':
    Compound: beta-ketoacyl-acp synthase III
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6R0 (0-316)
      • modified residue (0)
      • modified residue (24)
      • modified residue (53)
      • modified residue (64)
      • modified residue (96)
      • modified residue (206)
      • modified residue (259)
      • modified residue (261)
    Domains in SCOPe 2.05: d1eblb1, d1eblb2
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eblA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannndrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eblB (B:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannndrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf