PDB entry 1ebh

View 1ebh on RCSB PDB site
Description:
Deposited on 1994-11-01, released 1995-04-27
The last revision prior to the SCOP 1.57 freeze date was dated 1995-04-27, with a file datestamp of 1995-05-05.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1ebha1, d1ebha2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1ebhb1, d1ebhb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebhA (A:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebhB (B:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl