PDB entry 1ebf

View 1ebf on RCSB PDB site
Description: homoserine dehydrogenase from s. cerevisiae complex with nad+
Class: oxidoreductase
Keywords: dehydrogenase, dinucleotide, homoserine, NAD, dimer, OXIDOREDUCTASE
Deposited on 2000-01-24, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoserine dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HOM6P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebfa1, d1ebfa2
  • Chain 'B':
    Compound: homoserine dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HOM6P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebfb1, d1ebfb2
  • Heterogens: NA, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebfA (A:)
    stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
    alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
    sdlatwkalfsnkptngfvyheatvgaglpiisflreiiqtgdevekiegifsgtlsyif
    nefstsqandvkfsdvvkvakklgytepdprddlngldvarkvtivgrisgvevesptsf
    pvqslipkplesvksadefleklsdydkdltqlkkeaatenkvlrfigkvdvatksvsvg
    iekydyshpfaslkgsdnvisiktkrytnpvviqgagagaavtaagvlgdvikiaqrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebfB (B:)
    stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
    alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
    sdlatwkalfsnkptngfvyheatvgaglpiisflreiiqtgdevekiegifsgtlsyif
    nefstsqandvkfsdvvkvakklgytepdprddlngldvarkvtivgrisgvevesptsf
    pvqslipkplesvksadefleklsdydkdltqlkkeaatenkvlrfigkvdvatksvsvg
    iekydyshpfaslkgsdnvisiktkrytnpvviqgagagaavtaagvlgdvikiaqrl