PDB entry 1ebe

View 1ebe on RCSB PDB site
Description: laue diffraction study on the structure of cytochrome c peroxidase compound i
Deposited on 2001-07-25, released 2001-07-26
The last revision prior to the SCOP 1.69 freeze date was dated 2001-07-26, with a file datestamp of 2001-07-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.144
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ebea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ebeA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ebeA (A:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl