PDB entry 1ebd

View 1ebd on RCSB PDB site
Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase
Class: complex (oxidoreductase/transferase)
Keywords: redox-active center, glycolysis, oxidoreductase, complex (oxidoreductase/transferase) complex
Deposited on 1996-02-03, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebda1, d1ebda2, d1ebda3
  • Chain 'B':
    Compound: dihydrolipoamide dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebdb1, d1ebdb2, d1ebdb3
  • Chain 'C':
    Compound: dihydrolipoamide acetyltransferase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebdc_
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebdA (A:)
    aietetlvvgagpggyvaairaaqlgqkvtivekgnlggvclnvgcipskalisashrye
    qakhseemgikaenvtidfakvqewkasvvkkltggvegllkgnkveivkgeayfvdant
    vrvvngdsaqtytfknaiiatgsrpielpnfkfsnrildstgalnlgevpkslvvigggy
    igielgtayanfgtkvtilegageilsgfekqmaaiikkrlkkkgvevvtnalakgaeer
    edgvtvtyeangetktidadyvlvtvgrrpntdelgleqigikmtnrglievdqqcrtsv
    pnifaigdivpgpalahkasyegkvaaeaiaghpsavdyvaipavvfsdpecasvgyfeq
    qakdegidviaakfpfaangralalndtdgflklvvrkedgviigaqiigpnasdmiael
    glaieagmtaedialtihahptlgeiameaaeval
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebdB (B:)
    aietetlvvgagpggyvaairaaqlgqkvtivekgnlggvclnvgcipskalisashrye
    qakhseemgikaenvtidfakvqewkasvvkkltggvegllkgnkveivkgeayfvdant
    vrvvngdsaqtytfknaiiatgsrpielpnfkfsnrildstgalnlgevpkslvvigggy
    igielgtayanfgtkvtilegageilsgfekqmaaiikkrlkkkgvevvtnalakgaeer
    edgvtvtyeangetktidadyvlvtvgrrpntdelgleqigikmtnrglievdqqcrtsv
    pnifaigdivpgpalahkasyegkvaaeaiaghpsavdyvaipavvfsdpecasvgyfeq
    qakdegidviaakfpfaangralalndtdgflklvvrkedgviigaqiigpnasdmiael
    glaieagmtaedialtihahptlgeiameaaeval
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebdC (C:)
    iampsvrkyarekgvdirlvqgtgkngrvlkedidaflagg