PDB entry 1ebc

View 1ebc on RCSB PDB site
Description: sperm whale met-myoglobin:cyanide complex
Deposited on 1999-03-04, released 1999-08-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-13, with a file datestamp of 1999-08-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ebca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebcA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg