PDB entry 1ebb

View 1ebb on RCSB PDB site
Description: bacillus stearothermophilus yhfr
Deposited on 2001-07-24, released 2002-02-11
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-11, with a file datestamp of 2002-02-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ebba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebbA (A:)
    attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
    etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
    rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
    tiievdggtfhvavegdvshie