PDB entry 1ebb

View 1ebb on RCSB PDB site
Description: bacillus stearothermophilus yhfr
Class: hydrolase
Keywords: hydrolase, broad specificity phosphatase; dpgm homolog
Deposited on 2001-07-24, released 2002-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EBB (201-201)
      • conflict (108)
    • Uniprot Q9ALU0 (6-200)
    Domains in SCOPe 2.07: d1ebba_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebbA (A:)
    attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
    etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
    rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
    tiievdggtfhvavegdvshie